PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000401351
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family GATA
Protein Properties Length: 119aa    MW: 13170.1 Da    PI: 8.4957
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000401351genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA529.5e-17740235
           GATA  2 snCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                   ++Cgt +Tp+WR gp gnktLC aC ++yrk g+
  MDP0000401351  7 QHCGTETTPQWRPGPHGNKTLCDACEVRYRKSGK 40
                   69*****************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011410.211155IPR000679Zinc finger, GATA-type
SMARTSM004011.3E-8251IPR000679Zinc finger, GATA-type
PfamPF003201.1E-14740IPR000679Zinc finger, GATA-type
CDDcd002022.51E-12755No hitNo description
Gene3DG3DSA:3.30.50.101.7E-11741IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577164.51E-13861No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 119 aa     Download sequence    Send to blast
MIGRKGQHCG TETTPQWRPG PHGNKTLCDA CEVRYRKSGK LVPEYCPASS PTFSRELHSN  60
NLSKVMNLGH VVGAFPFVVW ADLDLLVWAR LSYVGQCSIL NYDERNSNLS HIVLTALL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010097024.16e-26GATA transcription factor 1
SwissprotQ8LAU91e-25GATA1_ARATH; GATA transcription factor 1
TrEMBLW9R3B36e-26W9R3B3_9R
STRINGAT3G24050.13e-23(Arabidopsis thaliana)
STRINGfgenesh2_kg.3__2631__AT3G24050.12e-23(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85372941
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.17e-27GATA transcription factor 1